DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Pbx4

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001101869.1 Gene:Pbx4 / 361131 RGDID:1305100 Length:379 Species:Rattus norvegicus


Alignment Length:203 Identity:53/203 - (26%)
Similarity:86/203 - (42%) Gaps:39/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLNSCI--EKSIQTKKKGKLGAFSIDSILSTSEAHSSQNSLPKDNTNVTSSDISKLY-------- 65
            ||::.:  |...:.:|:|:.||.:  ...:|.....:.||:...:.....|.|.::|        
  Rat    90 RLDNMLLAEGVSRPEKRGRGGAAA--GSTATPGGCPNDNSIEHSDYRAKLSQIRQIYHSELEKYE 152

  Fly    66 --AFSFTQEGNNKTPLTNFDLCQGHPRRLPITFDG------STV-SRFVWRTESILPSYITNSTN 121
              ...||      |.:||  |.:...|..|:: .|      ||: |:|     |.:...:..||.
  Rat   153 QACREFT------THVTN--LLREQSRVRPVS-SGEIEHMVSTIHSKF-----SAIQRQLKQSTC 203

  Fly   122 LQEKQLRKRFTD-RKPRQAYSASQLERLENEFN---LDKYLSVSKRVELSKSLSLTEVQVKTWFQ 182
            .....||.||.| |:.|:.:|....|.|...|.   .:.|.|...:.||::...:|..||..||.
  Rat   204 EAVMTLRSRFLDARRKRRNFSKQATEVLNEYFYSHLSNPYPSEETKEELARKGGITVSQVSNWFG 268

  Fly   183 NRRTKWKK 190
            |:|.::||
  Rat   269 NKRIRYKK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 16/55 (29%)
Pbx4NP_001101869.1 PBC 25..215 CDD:281746 33/140 (24%)
homeodomain 217..277 CDD:238039 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.