powered by:
Protein Alignment CG34031 and Hmx1
DIOPT Version :9
Sequence 1: | NP_001246894.1 |
Gene: | CG34031 / 3885665 |
FlyBaseID: | FBgn0054031 |
Length: | 219 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001101833.2 |
Gene: | Hmx1 / 360960 |
RGDID: | 1304928 |
Length: | 333 |
Species: | Rattus norvegicus |
Alignment Length: | 66 |
Identity: | 35/66 - (53%) |
Similarity: | 48/66 - (72%) |
Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 134 RKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKI 198
:|.|..:|.||:.:||:.|:|.:|||.::|..|:.||.|||.|||.||||||.|||:||.:.|:.
Rat 193 KKTRTVFSRSQVFQLESTFDLKRYLSSAERAGLAASLQLTETQVKIWFQNRRNKWKRQLAAELEA 257
Fly 199 A 199
|
Rat 258 A 258
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.