DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and cad

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster


Alignment Length:172 Identity:45/172 - (26%)
Similarity:79/172 - (45%) Gaps:39/172 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AFSIDSILSTSEAHSSQNSLPK-DNTNVTSSDISKLYAFSFTQEGNNKTPLTNFDLCQGHPRRLP 93
            |..:.::.:.:..:::.|:.|. .|.|..::.:|          .||:|          .|.:.|
  Fly   207 AHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVS----------NNNRT----------SPSKPP 251

  Fly    94 ITFDGSTVSRFVWRTESILPSY----ITNSTNLQE-----KQLRKRFTDRKPRQAYSASQLERLE 149
            .         |.|..:...|:.    :::|.||::     ....|..|..|.|..|:..|...||
  Fly   252 Y---------FDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELE 307

  Fly   150 NEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQ 191
            .|:...:|:::.::.||:::|||:|.|||.||||||.|.:||
  Fly   308 KEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQ 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 23/52 (44%)
cadNP_001260641.1 Homeobox 295..347 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.