DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and H2.0

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster


Alignment Length:333 Identity:65/333 - (19%)
Similarity:101/333 - (30%) Gaps:153/333 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNPHLEQDKSRLN---------SCIEKSI--------QTKKKGKLGAFSIDSILST--SEAHSSQ 46
            :||.|.:....:|         ||...:|        .:..|.|| :||:|.:|.:  .|:|...
  Fly    28 VNPTLAKCPDPVNVDHELPTKESCASTTIVSTSPTSATSTTKVKL-SFSVDRLLGSEPEESHRQS 91

  Fly    47 NSLPKDNTNVTSSDI---SKLYAFS-----------------FTQEGNNKTPLTNFDLC------ 85
            :|.|...:....|.:   |..:.||                 ||...::..|....|..      
  Fly    92 SSSPSTKSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPGPYM 156

  Fly    86 ----------------------------------------------QGHPRRL-----PITFDGS 99
                                                          |.||:.|     |...:.:
  Fly   157 DYKSVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNST 221

  Fly   100 TVSRFVWRTESILPSYITNSTNLQEKQLRKRFTDRKPRQ-------------------------- 138
            |.|..:....|:        |:||..|.::||..:.|:|                          
  Fly   222 TASALLAPLHSL--------TSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGG 278

  Fly   139 ----------------------AYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWF 181
                                  .:|..|.:.||.:|...||::...|.:|:..|:||:.|||.||
  Fly   279 GNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWF 343

  Fly   182 QNRRTKWK 189
            ||||.||:
  Fly   344 QNRRMKWR 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 24/100 (24%)
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.