DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and AgaP_AGAP012501

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_558008.4 Gene:AgaP_AGAP012501 / 3292406 VectorBaseID:AGAP012501 Length:97 Species:Anopheles gambiae


Alignment Length:71 Identity:28/71 - (39%)
Similarity:44/71 - (61%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 RKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQL 192
            |:|  .|:.|..::..||:.||..|....|..|..|.|::..::|:|.:|:.||||||.||:|| 
Mosquito    23 RRR--QRRNRTTFTPQQLQELEQLFKKTHYPDVFLREEVALRINLSEARVQVWFQNRRAKWRKQ- 84

  Fly   193 TSRLKI 198
             :||::
Mosquito    85 -ARLQL 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 20/52 (38%)
AgaP_AGAP012501XP_558008.4 Homeobox 31..82 CDD:278475 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.