powered by:
Protein Alignment CG34031 and AgaP_AGAP012501
DIOPT Version :9
Sequence 1: | NP_001246894.1 |
Gene: | CG34031 / 3885665 |
FlyBaseID: | FBgn0054031 |
Length: | 219 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_558008.4 |
Gene: | AgaP_AGAP012501 / 3292406 |
VectorBaseID: | AGAP012501 |
Length: | 97 |
Species: | Anopheles gambiae |
Alignment Length: | 71 |
Identity: | 28/71 - (39%) |
Similarity: | 44/71 - (61%) |
Gaps: | 4/71 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 128 RKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQL 192
|:| .|:.|..::..||:.||..|....|..|..|.|::..::|:|.:|:.||||||.||:||
Mosquito 23 RRR--QRRNRTTFTPQQLQELEQLFKKTHYPDVFLREEVALRINLSEARVQVWFQNRRAKWRKQ- 84
Fly 193 TSRLKI 198
:||::
Mosquito 85 -ARLQL 89
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.