DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34031 and HOXD8

DIOPT Version :9

Sequence 1:	NP_001246894.1	Gene:	CG34031 / 3885665	FlyBaseID:	FBgn0054031	Length:	219	Species:	Drosophila melanogaster
Sequence 2:	NP_062458.1	Gene:	HOXD8 / 3234	HGNCID:	5139	Length:	290	Species:	Homo sapiens

Alignment Length:	136	Identity:	46/136 - (33%)
Similarity:	63/136 - (46%)	Gaps:	38/136 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly    85 CQGHP---------RRLPITFDGSTVSRFVWRTESIL---PSYITNSTNLQEKQ----------- 126
            |.|.|         :|.||         |..:.|:.|   |...::|.|:.|..
Human   129 CHGEPAKFYGYDNLQRQPI---------FTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQ 184

  Fly   127 ----LRKRFTD--RKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRR 185
                :|.:...  |:.||.||..|...||.||..:.||:..:|:|:|.:|:|||.|||.||||||
Human   185 MFPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRR 249

  Fly   186 TKWKKQ 191
            .||||:
Human   250 MKWKKE 255

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34031	NP_001246894.1	Homeobox	136..189	CDD:278475	28/52 (54%)
HOXD8	NP_062458.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	60..127
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	161..200		5/38 (13%)
		Homeobox	201..253	CDD:278475	28/51 (55%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	255..290		0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000007
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.910