DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and HOXD4

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens


Alignment Length:142 Identity:40/142 - (28%)
Similarity:65/142 - (45%) Gaps:45/142 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 QGHPRRLPITFDGSTVSR----FVW----RTESILPSYITNSTNLQEKQLRKRFTDRKPRQAYSA 142
            |..|::.|   .|:.:.:    :.|    ...|:.|:|....             .::.|.||:.
Human   115 QSDPKQPP---SGTALKQPAVVYPWMKKVHVNSVNPNYTGGE-------------PKRSRTAYTR 163

  Fly   143 SQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKIAHRHGLWIP 207
            .|:..||.||:.::||:..:|:|::.:|.|:|.|:|.||||||.||||.        |:      
Human   164 QQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKD--------HK------ 214

  Fly   208 TLPITTIIPNTK 219
                   :||||
Human   215 -------LPNTK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 24/52 (46%)
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127 4/14 (29%)
Antp-type hexapeptide 133..138 1/4 (25%)
Homeobox 157..210 CDD:306543 24/52 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 5/29 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.