DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and HOXA2

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_006726.1 Gene:HOXA2 / 3199 HGNCID:5103 Length:376 Species:Homo sapiens


Alignment Length:224 Identity:64/224 - (28%)
Similarity:91/224 - (40%) Gaps:56/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNPHLEQDKSRLNS------CIEKSIQTKKKGKLGAFSIDSILSTSEAHSSQNSLPKDNTNVTSS 59
            ||...|::...:||      |:     |........|...||.:::.:||:....|.:.|     
Human     1 MNYEFEREIGFINSQPSLAECL-----TSFPPVADTFQSSSIKTSTLSHSTLIPPPFEQT----- 55

  Fly    60 DISKLYAFSFTQEGNNKTPLTNFDLCQGHPRRLPITFDGSTV-------SRFVWRTE-------S 110
             |..|...|..:.|           ..|.|:..|....||.|       ..:.|..|       :
Human    56 -IPSLNPGSHPRHG-----------AGGRPKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTA 108

  Fly   111 ILPSYITNSTN-------LQEKQLRKRFTD------RKPRQAYSASQLERLENEFNLDKYLSVSK 162
            :||:....:|.       |..|: .....|      |:.|.||:.:||..||.||:.:|||...:
Human   109 LLPAAAAAATAAATGPACLSHKE-SLEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPR 172

  Fly   163 RVELSKSLSLTEVQVKTWFQNRRTKWKKQ 191
            |||::..|.|||.|||.||||||.|.|:|
Human   173 RVEIAALLDLTERQVKVWFQNRRMKHKRQ 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 29/52 (56%)
HOXA2NP_006726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..93 14/67 (21%)
Antp-type hexapeptide 94..99 1/4 (25%)
Homeobox 147..200 CDD:395001 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..229 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.