DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and HLX

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_068777.1 Gene:HLX / 3142 HGNCID:4978 Length:488 Species:Homo sapiens


Alignment Length:174 Identity:47/174 - (27%)
Similarity:73/174 - (41%) Gaps:30/174 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 HSSQNSLPKDNTNVTSSDISKLYAFSF---TQEGNNKTPLTNFDLCQGHPRRLPITFDGSTVSRF 104
            ||  .|.|..::......|.::.:..|   .:|||....||:. |..|.|..:.::....:..:|
Human   162 HS--GSAPAPSSKDLKFGIDRILSAEFDPKVKEGNTLRDLTSL-LTGGRPAGVHLSGLQPSAGQF 223

  Fly   105 ------VWRTESILPSYITNSTNLQEKQLRKRF--------TDRKP----------RQAYSASQL 145
                  :....:||....:|..|..:.|.:..|        .|..|          |..:|..|.
Human   224 FASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQR 288

  Fly   146 ERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWK 189
            :.||..|.:.||::...|.:|:..|.||:.|||.||||||.||:
Human   289 KGLEKRFEIQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 24/62 (39%)
HLXNP_068777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..173 4/12 (33%)
Abdominal-A 227..>344 CDD:332641 32/106 (30%)
Homeobox 279..332 CDD:306543 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 331..488 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.