DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Nkx6-2

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001101028.1 Gene:Nkx6-2 / 309095 RGDID:1307280 Length:277 Species:Rattus norvegicus


Alignment Length:125 Identity:41/125 - (32%)
Similarity:64/125 - (51%) Gaps:14/125 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LCQGHPR-------RLPITFDGSTVSRFVWRTESILPSYITNSTNLQEKQLRKRFTDRKPRQAYS 141
            :.:|:|:       |.||.:.| .|....||...:..|  ..:..:.:|..:|:.:    |..:|
  Rat    99 VARGYPKPLAELPGRPPIFWPG-VVQGSPWRDPRLAGS--AQAGGVLDKDGKKKHS----RPTFS 156

  Fly   142 ASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKIAHR 201
            ..|:..||..|...|||:..:|..|:.||.:||.|||.|||||||||:|:..:.:..|.:
  Rat   157 GQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 26/52 (50%)
Nkx6-2NP_001101028.1 Homeobox 151..205 CDD:395001 27/57 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.