DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and nkx2.2a

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001295569.1 Gene:nkx2.2a / 30697 ZFINID:ZDB-GENE-980526-403 Length:273 Species:Danio rerio


Alignment Length:206 Identity:55/206 - (26%)
Similarity:86/206 - (41%) Gaps:38/206 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SIQTKKKGKLGAFSIDSILSTSEAHSSQNSLPKDNTNVTSSDISKLYAFSFTQEGNNKTPLTNFD 83
            |:...|.|    ||:..||...:.:..:.|:.....:...|:.:|      |.....::||.|  
Zfish     6 SLTNTKTG----FSVKDILDLPDTNDEEGSITGTEEDTEGSEATK------TPGVLVQSPLEN-- 58

  Fly    84 LCQGHPRRLPITFDGS--TVSRFVWRTESILPSYITNSTNLQ-----------------EKQLRK 129
             .|..|.:.|. :|.|  ..:|::..|:||..|....|.|.|                 :|:...
Zfish    59 -VQNLPLKNPF-YDNSDNPYTRWLATTDSIQYSLHGLSANSQDTSAKSPEPSADESPDNDKETSS 121

  Fly   130 RFTD----RKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKK 190
            ..:|    ||.|..:|.:|...||..|...:|||..:|..|:..:.||..|||.||||.|.|.|:
Zfish   122 NGSDSGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKR 186

  Fly   191 QLTSR-LKIAH 200
            ....: :::.|
Zfish   187 ARAEKGMEVTH 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 22/52 (42%)
nkx2.2aNP_001295569.1 COG5576 93..218 CDD:227863 31/105 (30%)
Homeobox 132..185 CDD:278475 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.