DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and dlx2a

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_571386.2 Gene:dlx2a / 30574 ZFINID:ZDB-GENE-980526-212 Length:274 Species:Danio rerio


Alignment Length:206 Identity:58/206 - (28%)
Similarity:82/206 - (39%) Gaps:63/206 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KGKLGAFSIDSI--------LSTSEAHSSQNSLPKDNTNVTSSDISKLYAFSFTQEGNNKTPLTN 81
            |...|.|  ||:        :::|..||...|.......|:::..|..|        ||     |
Zfish     2 KNMTGVF--DSLSTDMHSNQITSSSYHSLHKSQESPTLPVSTATDSSYY--------NN-----N 51

  Fly    82 FDLCQGHPRRLPITFDGSTVSRFVWRTESI-LPSYITNSTNL----------------------- 122
            ...|.|.|.        ..:|.:.::..|: ...|.|.|..|                       
Zfish    52 NQQCAGSPY--------GQISSYQYQNNSMNSVQYNTKSYELGFGNAFGPYGTYGSCSSPTPADA 108

  Fly   123 ----QEKQLR----KRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKT 179
                .|.::|    |....||||..||:.||..|:..|...:||::.:|.||:.||.||:.|||.
Zfish   109 EKEESEPEIRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKI 173

  Fly   180 WFQNRRTKWKK 190
            ||||||:|:||
Zfish   174 WFQNRRSKFKK 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 27/52 (52%)
dlx2aNP_571386.2 DLL_N 32..107 CDD:289198 15/95 (16%)
Homeobox 130..183 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.