DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and rx3

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_571302.1 Gene:rx3 / 30474 ZFINID:ZDB-GENE-990415-238 Length:292 Species:Danio rerio


Alignment Length:119 Identity:40/119 - (33%)
Similarity:56/119 - (47%) Gaps:16/119 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 FDGSTVSRFVWRTESILP----SYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDK 156
            |||  |.|........||    ..:::..|.::|..|.|.|       ::..||..||..|....
Zfish    74 FDG--VCRSTVMVSPDLPDADGGKLSDDENPKKKHRRNRTT-------FTTFQLHELERAFEKSH 129

  Fly   157 YLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQ---LTSRLKIAHRHGLWIP 207
            |..|..|.||:..::|.||:|:.||||||.||::|   ..|.:|:.....|.||
Zfish   130 YPDVYSREELALKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSIKLQESSMLSIP 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 21/52 (40%)
rx3NP_571302.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Octapeptide motif 32..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..72
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..107 4/21 (19%)
Homeobox 110..162 CDD:278475 23/58 (40%)
OAR 268..284 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 272..285
Nuclear localization signal. /evidence=ECO:0000255 278..282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.