DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and hoxc3a

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001128157.2 Gene:hoxc3a / 30421 ZFINID:ZDB-GENE-980526-532 Length:263 Species:Danio rerio


Alignment Length:192 Identity:52/192 - (27%)
Similarity:98/192 - (51%) Gaps:30/192 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LNSCIEKSIQTKKKGKLGAFSIDSILSTSEAHSSQNSLPKDNTNVTS-SDISKL-YAFSFTQEGN 74
            |.:.:.|.::|::..           ||.:.|:.::|...|..||.: .::|.: :.:||:.:||
Zfish    41 LFTLVGKQLKTRENS-----------STWKRHAEESSSENDKGNVWNFQNLSNVQHPYSFSDDGN 94

  Fly    75 NKTPLTNFDLCQGHPRRLPITFDGSTVS--RFVWRTESILPSYITNSTNLQE---------KQLR 128
            :     :.|......|........|.:|  ::.|..|:..|::. :|.|..|         :.:.
Zfish    95 H-----SLDPANALEREKACELSTSCLSTMKYPWMRETHAPTHF-SSINAMESGDSKYSNGEAVV 153

  Fly   129 KRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKK 190
            :..:.::.|.|:::|||..||.||:...||..::|:|:::.|.||:.|:|.||||||.|:||
Zfish   154 RNSSSKRARVAFTSSQLLELEKEFHFSAYLCRNRRLEMAELLKLTDRQIKIWFQNRRMKYKK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 25/52 (48%)
hoxc3aNP_001128157.2 Abdominal-A 123..246 CDD:332641 33/94 (35%)
Homeobox 162..214 CDD:306543 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.