DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and hoxc5a

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_571219.2 Gene:hoxc5a / 30379 ZFINID:ZDB-GENE-980526-533 Length:233 Species:Danio rerio


Alignment Length:234 Identity:66/234 - (28%)
Similarity:101/234 - (43%) Gaps:52/234 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LNSCIEKSI--QTKKKGKLGAFSIDSILSTSEAHSSQ------------------NSLPKDNTNV 56
            ::|.:.||.  ||:........:.|:..:.||.|.|.                  |||.::..|.
Zfish     1 MSSYVGKSFSKQTQDASSCRMHTFDNYGAHSEFHESNYAYEGLDLGGSFSSQIPTNSLRREAINT 65

  Fly    57 T-----------SSDISKLYAFSF-TQEGNNKTPLTNFDLCQGHPRRLPITFDGSTVSR---FVW 106
            |           :...|.|.:.|| :..|.|  ||::..|.|.....:.:....|..||   ...
Zfish    66 TDRARSSAAVQRTQSCSALGSRSFVSTHGYN--PLSHGLLSQKAEGNMEVMEKPSGKSRTDDIKM 128

  Fly   107 RTESILPSYITNST---NLQEKQLRKRFT---------DRKPRQAYSASQLERLENEFNLDKYLS 159
            .|.|.:... ||||   |..:.|:....|         .::.|.:|:..|...||.||:.::||:
Zfish   129 ETTSAIKQQ-TNSTQRQNQSQPQIYPWMTKLHMSHESDGKRSRTSYTRYQTLELEKEFHFNRYLT 192

  Fly   160 VSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKI 198
            ..:|:|::.:|.|.|.|:|.||||||.||||.  |:||:
Zfish   193 RRRRIEIANNLCLNERQIKIWFQNRRMKWKKD--SKLKV 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 23/52 (44%)
hoxc5aNP_571219.2 Homeobox 169..222 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.