DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Hoxb1

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_220896.4 Gene:Hoxb1 / 303491 RGDID:1310298 Length:297 Species:Rattus norvegicus


Alignment Length:162 Identity:55/162 - (33%)
Similarity:70/162 - (43%) Gaps:33/162 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PKDNTNVTSSDISKLYAFSFTQEGNNKTPLTNFDLCQGHPRRLPI-TFDGSTVSRFVWRTESILP 113
            |...|..||:..|   |:....|....:       |...|..|.. |||...|.|...:|..:  
  Rat   139 PPYGTEQTSNFAS---AYDLLSEDKESS-------CSSEPSSLTARTFDWMKVKRNPPKTAKV-- 191

  Fly   114 SYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVK 178
            |.:...|   ...||..||.|         ||..||.||:.:||||.::|||::.:|.|.|.|||
  Rat   192 SELGLGT---PGGLRTNFTTR---------QLTELEKEFHFNKYLSRARRVEIAATLELNETQVK 244

  Fly   179 TWFQNRRTKWKKQLTSRLKIAHRHGLWIPTLP 210
            .||||||.|.||:        .|.|..:|..|
  Rat   245 IWFQNRRMKQKKR--------EREGGRVPAGP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 26/52 (50%)
Hoxb1XP_220896.4 Homeobox 203..255 CDD:278475 30/60 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.