DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Dlx4

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001100510.1 Gene:Dlx4 / 303469 RGDID:1308744 Length:238 Species:Rattus norvegicus


Alignment Length:203 Identity:57/203 - (28%)
Similarity:81/203 - (39%) Gaps:42/203 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AFSIDSILSTSEAHSSQNSLPKDNTNVTSSDISKLYAFSFTQEGNNKTPLTNFDLCQGHPRRLPI 94
            |.|.|...|.:..|....|.|...|...|      |..|..|   :..|...|.....||:.|..
  Rat    40 AASPDLSFSQTYGHLLSYSYPGPATPGDS------YLSSQQQ---SAAPSRPFHQPTEHPQELEA 95

  Fly    95 TFDGSTVSRFVWRTESILPSYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLS 159
                        .:|.:..|...:..:|..|.       ||||..||:.||:.|...|...:||:
  Rat    96 ------------ESEKLALSLEPSQPSLTRKL-------RKPRTIYSSLQLQHLNQRFQHTQYLA 141

  Fly   160 VSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQL-----------TSRLKIAHRHGLWIPT---LP 210
            :.:|.:|:..|.||:.|||.||||:|:|:||.|           :.|......|.|.:|:   ||
  Rat   142 LPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSGELEEDFSGRPPSLSPHSLTLPSIWDLP 206

  Fly   211 ITTIIPNT 218
            ....:|.:
  Rat   207 KAGTLPTS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 24/52 (46%)
Dlx4NP_001100510.1 Homeobox 118..172 CDD:395001 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.