DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Hoxd3

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001257967.1 Gene:Hoxd3 / 288152 RGDID:1588601 Length:432 Species:Rattus norvegicus


Alignment Length:103 Identity:43/103 - (41%)
Similarity:59/103 - (57%) Gaps:16/103 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 STVSR--FVWRTESILPSYITNS-----TNLQEKQ----LRKRFTDRKPRQAYSASQLERLENEF 152
            ||:|:  |.|..||...|...||     .|.::|.    ..||.     |.||:::||..||.||
  Rat   154 STISKQIFPWMKESRQNSKQKNSCATSGENCEDKSPPGPASKRV-----RTAYTSAQLVELEKEF 213

  Fly   153 NLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKK 190
            :.::||...:|||::..|:|||.|:|.||||||.|:||
  Rat   214 HFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 27/52 (52%)
Hoxd3NP_001257967.1 Homeobox 198..251 CDD:395001 27/52 (52%)
DUF4074 369..430 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.