DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Hoxb9

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001093967.1 Gene:Hoxb9 / 287647 RGDID:1306158 Length:250 Species:Rattus norvegicus


Alignment Length:73 Identity:32/73 - (43%)
Similarity:43/73 - (58%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 NSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQ 182
            :.||.....|..| :.||.|..|:..|...||.||..:.||:..:|.|:::.|:|:|.|||.|||
  Rat   171 DQTNPSANWLHAR-SSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQ 234

  Fly   183 NRRTKWKK 190
            |||.|.||
  Rat   235 NRRMKMKK 242

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 24/52 (46%)