DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and GBX2

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001476.2 Gene:GBX2 / 2637 HGNCID:4186 Length:348 Species:Homo sapiens


Alignment Length:169 Identity:51/169 - (30%)
Similarity:77/169 - (45%) Gaps:37/169 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SILSTSEAHSSQNSL-------PKDNTNVTSSDISKLYAFS------FTQEGNNKTPLTNFDLCQ 86
            |:|:.|.|.:.|.||       .||.:.|......|..:||      ::.:.|......:.:...
Human   160 SLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDP 224

  Fly    87 GHPRRLPITFDGSTVSRFVWRTESILPSYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENE 151
            ||.........|:..|              |.||.          .:|:.|.|:::.||..||.|
Human   225 GHALEETPPSSGAAGS--------------TTSTG----------KNRRRRTAFTSEQLLELEKE 265

  Fly   152 FNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKK 190
            |:..||||:::|.:::.:|.|:|||||.||||||.|||:
Human   266 FHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 27/52 (52%)
GBX2NP_001476.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 15/95 (16%)
Homeobox 250..303 CDD:306543 27/52 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.