DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Dbx2

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_997416.2 Gene:Dbx2 / 223843 MGIID:107445 Length:377 Species:Mus musculus


Alignment Length:120 Identity:44/120 - (36%)
Similarity:57/120 - (47%) Gaps:27/120 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 CQGHPRR--LPITFDGSTVSRFVWRTESILPSYITNSTNLQEKQ--LRKRFTDRKPRQAYSASQL 145
            |.|..||  .|..|.         |.|..|| .:|..:|.:.::  ||        |..:|..|.
Mouse   192 CGGSCRRPASPTAFS---------REEHGLP-LLTQDSNSKARRGILR--------RAVFSEEQR 238

  Fly   146 ERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKW-----KKQLTSR 195
            :.||..|...||:|.:.|.:|:.||.|.|.|||.||||||.||     |:.|:||
Mouse   239 KALEKMFQKQKYISKTDRRKLAVSLGLKESQVKIWFQNRRMKWRNSKEKEVLSSR 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 26/57 (46%)
Dbx2NP_997416.2 COG5576 <217..334 CDD:227863 33/85 (39%)
Homeobox 229..282 CDD:278475 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.