Sequence 1: | NP_001246894.1 | Gene: | CG34031 / 3885665 | FlyBaseID: | FBgn0054031 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038861.2 | Gene: | Rax / 19434 | MGIID: | 109632 | Length: | 342 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 58/199 - (29%) |
---|---|---|---|
Similarity: | 87/199 - (43%) | Gaps: | 37/199 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 SRLNSCIEKSIQ-TKKKGKLGAFSIDSILSTSEAH----SSQNSLPKDNTNVTSSDISKLYAFSF 69
Fly 70 TQEGNNKTPLTNFDLC----QGHPRRLPITFDGSTVSRFVWRTESILPSYITNSTNLQEKQLRKR 130
Fly 131 FTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSR 195
Fly 196 LKIA 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34031 | NP_001246894.1 | Homeobox | 136..189 | CDD:278475 | 22/52 (42%) |
Rax | NP_038861.2 | Octapeptide motif | 33..40 | 3/7 (43%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 44..140 | 25/120 (21%) | |||
Homeobox | 140..192 | CDD:278475 | 22/51 (43%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 208..295 | ||||
OAR | 316..331 | CDD:281777 | |||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 319..332 | ||||
Nuclear localization signal. /evidence=ECO:0000255 | 325..329 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |