DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Rax

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_038861.2 Gene:Rax / 19434 MGIID:109632 Length:342 Species:Mus musculus


Alignment Length:199 Identity:58/199 - (29%)
Similarity:87/199 - (43%) Gaps:37/199 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SRLNSCIEKSIQ-TKKKGKLGAFSIDSILSTSEAH----SSQNSLPKDNTNVTSSDISKLYAFSF 69
            |||:| ||..:. ||:.|.|..|..:....:|:..    .:|.:.||  .....|:.|...|..|
Mouse    30 SRLHS-IEAILGFTKEDGILDTFPAERSSRSSKERDPRLGAQPACPK--APAGGSESSPPAAPGF 91

  Fly    70 TQEGNNKTPLTNFDLC----QGHPRRLPITFDGSTVSRFVWRTESILPSYITNSTNLQEKQLRKR 130
            ..|.....|      |    ||..|..|    |.:|.          |:  ...:.|.|::..|:
Mouse    92 VPEYEATRP------CYPKEQGEARPSP----GLSVG----------PA--AGDSKLSEEEPPKK 134

  Fly   131 FTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSR 195
             ..|:.|..::..||..||..|....|..|..|.||:..::|.||:|:.||||||.||::|  .:
Mouse   135 -KHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQ--EK 196

  Fly   196 LKIA 199
            |:::
Mouse   197 LEVS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 22/52 (42%)
RaxNP_038861.2 Octapeptide motif 33..40 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..140 25/120 (21%)
Homeobox 140..192 CDD:278475 22/51 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..295
OAR 316..331 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 319..332
Nuclear localization signal. /evidence=ECO:0000255 325..329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.