DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and ceh-30

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_508524.2 Gene:ceh-30 / 191620 WormBaseID:WBGene00000451 Length:237 Species:Caenorhabditis elegans


Alignment Length:209 Identity:62/209 - (29%)
Similarity:91/209 - (43%) Gaps:45/209 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGAFSID----SILSTSEAHSSQNSLPKDNTNVTSSDISKLYAFSFTQEGNNKTPLTNFDLCQGH 88
            |.||.:|    ::|:.:.:.|..|.: ..:::...|||       ..|..||.:...:.|     
 Worm    11 LPAFYLDPTTQALLAQAASTSPCNKI-SSSSSFRISDI-------LEQSPNNSSHSNDHD----- 62

  Fly    89 PRRLPITFDGSTVSRFVWRTESILPSYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFN 153
            |....|..|.||..|          :.......:......|:  .||.|..::..||:.|||.|.
 Worm    63 PSPQSIKSDFSTSPR----------ASSPGGDRMGSPGSCKK--SRKARTIFTDKQLQELENTFE 115

  Fly   154 LDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKIAHRHG-------------LW 205
            ..|||||..|::|:..:.||:.|||||:||||||||:|.||.:.:....|             .|
 Worm   116 KQKYLSVQDRMDLAHRMGLTDTQVKTWYQNRRTKWKRQATSGMDLLSEPGNLSAVQNLIRSSPYW 180

  Fly   206 ---IPTLPITTIIP 216
               |..||:.|.:|
 Worm   181 ANYITALPMGTQLP 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 27/52 (52%)
ceh-30NP_508524.2 Homeobox 99..151 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.