DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and ceh-62

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_496326.2 Gene:ceh-62 / 187642 WormBaseID:WBGene00011069 Length:278 Species:Caenorhabditis elegans


Alignment Length:157 Identity:50/157 - (31%)
Similarity:74/157 - (47%) Gaps:23/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SSQNSLPKDNTNVTSSDISKLYAFSFTQEGN----NKTPLTNFDLCQGHPRRLPITFDGSTVSRF 104
            :|.:.||.|::.........|.|.:..|:.:    :..|:.:|.     |:.||.......::  
 Worm    18 TSGHDLPVDDSLRLLLSAEALIALAQLQDASKILPSYEPVKDFS-----PQLLPAMTPTPIIA-- 75

  Fly   105 VWRTESI--LPSYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELS 167
               |.||  .|..:.:.:...||..|||.|       :|..|..|||.|:..|.|::..||..|:
 Worm    76 ---TPSIPEQPQPLQSPSAPNEKSRRKRTT-------FSPEQATRLEAEYIGDSYMAREKRHLLA 130

  Fly   168 KSLSLTEVQVKTWFQNRRTKWKKQLTS 194
            :||.|:|.||||||||||.|.|:...|
 Worm   131 QSLKLSENQVKTWFQNRRAKDKRDRKS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 26/52 (50%)
ceh-62NP_496326.2 Homeobox 99..152 CDD:278475 29/59 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.