DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Pdx1

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_032840.1 Gene:Pdx1 / 18609 MGIID:102851 Length:284 Species:Mus musculus


Alignment Length:59 Identity:31/59 - (52%)
Similarity:43/59 - (72%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQ 191
            :::.|.||:.:||..||.||..:||:|..:||||:..|:|||..:|.||||||.||||:
Mouse   147 NKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 28/52 (54%)
Pdx1NP_032840.1 Transactivation domain. /evidence=ECO:0000250 13..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..116
Antp-type hexapeptide 119..124
Homeobox 150..203 CDD:278475 28/52 (54%)
Nuclear localization signal 198..204 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..284 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.