DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Nkx6-1

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_659204.1 Gene:Nkx6-1 / 18096 MGIID:1206039 Length:365 Species:Mus musculus


Alignment Length:129 Identity:44/129 - (34%)
Similarity:63/129 - (48%) Gaps:12/129 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GNNKTPLTNFDLCQGHPRRLPITFDGSTVSRFVWRTESILPSYITNSTNLQEKQLRKRFTDRKPR 137
            |....||...      |.|.||.:.|...|. .|| ::.|.......:.|.:|..:::.|    |
Mouse   189 GRYPKPLAEL------PGRTPIFWPGVMQSP-PWR-DARLACTPHQGSILLDKDGKRKHT----R 241

  Fly   138 QAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKIAHR 201
            ..:|..|:..||..|...|||:..:|..|:.||.:||.|||.|||||||||:|:..:.:..|.:
Mouse   242 PTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 26/52 (50%)
Nkx6-1NP_659204.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..136
Repressor domain. /evidence=ECO:0000250 102..269 25/91 (27%)
Homeobox 240..293 CDD:278475 27/56 (48%)
DUF3381 <291..345 CDD:288694 4/15 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..365 1/11 (9%)
Involved in DNA-binding. /evidence=ECO:0000250 307..365
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.