DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Nkx2-2

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_035049.1 Gene:Nkx2-2 / 18088 MGIID:97347 Length:273 Species:Mus musculus


Alignment Length:209 Identity:50/209 - (23%)
Similarity:75/209 - (35%) Gaps:74/209 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KKKGKLGAFSIDSILSTSEAHSSQNSLPKDNTNVTSSD----------------ISKLYAFSFTQ 71
            |:.|.||..::|::          .|||..:....|||                :..|.|.:..|
Mouse    43 KRAGPLGQGALDAV----------QSLPLKSPFYDSSDNPYTRWLASTEGLQYSLHGLAASAPPQ 97

  Fly    72 EGNNKTPLTNFDLCQGHPRRLPITFDGSTVSRFVWRTESILPSYITNSTNLQEKQ-----LRKRF 131
            :.::|:|                                 .||...:..|.:|.|     ..|: 
Mouse    98 DSSSKSP---------------------------------EPSADESPDNDKETQGGGGDAGKK- 128

  Fly   132 TDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRL 196
              ||.|..:|.:|...||..|...:|||..:|..|:..:.||..|||.||||.|.|.|:....: 
Mouse   129 --RKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEK- 190

  Fly   197 KIAHRHGLWIPTLP 210
                  |:.:..||
Mouse   191 ------GMEVTPLP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 22/52 (42%)
Nkx2-2NP_035049.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 5/12 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..131 11/75 (15%)
Homeobox 131..185 CDD:395001 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.