DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and DLX1

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_835221.2 Gene:DLX1 / 1745 HGNCID:2914 Length:255 Species:Homo sapiens


Alignment Length:158 Identity:47/158 - (29%)
Similarity:75/158 - (47%) Gaps:28/158 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 HSSQNSLPKDNTNVTSSDISKLYAFSFTQEGNNKTPLTNFDLCQGHPRRLPITFDGSTVSRFVWR 107
            ||:.:|.| |....::|..|:...:.:....::..........|.:|        ||.       
Human    46 HSAGHSQP-DGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYP--------GSA------- 94

  Fly   108 TESILPSYITN-------STNLQEKQLR---KRFTDRKPRQAYSASQLERLENEFNLDKYLSVSK 162
              |:..|.:.:       ||.::..::|   |....||||..||:.||:.|...|...:||::.:
Human    95 --SLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPE 157

  Fly   163 RVELSKSLSLTEVQVKTWFQNRRTKWKK 190
            |.||:.||.||:.|||.||||:|:|:||
Human   158 RAELAASLGLTQTQVKIWFQNKRSKFKK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 26/52 (50%)
DLX1NP_835221.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..118 4/22 (18%)
Homeobox 131..185 CDD:395001 26/53 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.