DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34031 and Hoxd8

DIOPT Version :9

Sequence 1:	NP_001246894.1	Gene:	CG34031 / 3885665	FlyBaseID:	FBgn0054031	Length:	219	Species:	Drosophila melanogaster
Sequence 2:	NP_032302.2	Gene:	Hoxd8 / 15437	MGIID:	96209	Length:	289	Species:	Mus musculus

Alignment Length:	136	Identity:	46/136 - (33%)
Similarity:	63/136 - (46%)	Gaps:	38/136 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly    85 CQGHP---------RRLPITFDGSTVSRFVWRTESIL---PSYITNSTNLQEKQ----------- 126
            |.|.|         :|.||         |..:.|:.|   |...::|.|:.|..
Mouse   127 CHGEPAKFYGYDNLQRQPI---------FTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQ 182

  Fly   127 ----LRKRFTD--RKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRR 185
                :|.:...  |:.||.||..|...||.||..:.||:..:|:|:|.:|:|||.|||.||||||
Mouse   183 MFPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHTLALTERQVKIWFQNRR 247

  Fly   186 TKWKKQ 191
            .||||:
Mouse   248 MKWKKE 253

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34031	NP_001246894.1	Homeobox	136..189	CDD:278475	28/52 (54%)
Hoxd8	NP_032302.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	62..125
		COG5576	139..272	CDD:227863	43/124 (35%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	162..184		3/21 (14%)
		Antp-type hexapeptide	183..188		0/4 (0%)
		Homeobox	199..251	CDD:278475	28/51 (55%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	252..289		1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000007
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000