DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Hoxb7

DIOPT Version :10

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_034590.2 Gene:Hoxb7 / 15415 MGIID:96188 Length:217 Species:Mus musculus


Alignment Length:66 Identity:32/66 - (48%)
Similarity:45/66 - (68%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LRKRFTDRK-PRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKK 190
            :|....||| .||.|:..|...||.||:.::||:..:|:|::.:|.|||.|:|.||||||.||||
Mouse   130 MRSSGPDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKK 194

  Fly   191 Q 191
            :
Mouse   195 E 195

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeodomain 134..190 CDD:459649 28/56 (50%)