DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34031 and Hoxa3

DIOPT Version :9

Sequence 1:	NP_001246894.1	Gene:	CG34031 / 3885665	FlyBaseID:	FBgn0054031	Length:	219	Species:	Drosophila melanogaster
Sequence 2:	NP_034582.1	Gene:	Hoxa3 / 15400	MGIID:	96175	Length:	443	Species:	Mus musculus

Alignment Length:	153	Identity:	48/153 - (31%)
Similarity:	65/153 - (42%)	Gaps:	58/153 - (37%)

- Green bases have known domain annotations that are detailed below.

  Fly    70 TQEGNNKTPLTNFDLCQGHPRRLPITFDGSTVSR--FVWRTESILPSYITNSTNLQEKQLRKRFT 132
            |.....|:||.|                ..||.:  |.|..||              :|..|:.|
Mouse   137 TPASTAKSPLLN----------------SPTVGKQIFPWMKES--------------RQNTKQKT 171

  Fly   133 -----------DRKP---------RQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQV 177
                       |:.|         |.||:::||..||.||:.::||...:|||::..|:|||.|:
Mouse   172 SGSSSGESCAGDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQI 236

  Fly   178 KTWFQNRRTKWKK------QLTS 194
            |.||||||.|:||      .|||
Mouse   237 KIWFQNRRMKYKKDQKGKGMLTS 259

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34031	NP_001246894.1	Homeobox	136..189	CDD:278475	28/61 (46%)
Hoxa3	NP_034582.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	74..151		5/29 (17%)
		Antp-type hexapeptide	156..161		2/4 (50%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	163..197		6/47 (13%)
		COG5576	<182..309	CDD:227863	34/78 (44%)
		Homeobox	196..249	CDD:365835	27/52 (52%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	248..354		5/12 (42%)
		DUF4074	378..441	CDD:372548
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	401..443
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910