DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Hoxa3

DIOPT Version :10

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_034582.1 Gene:Hoxa3 / 15400 MGIID:96175 Length:443 Species:Mus musculus


Alignment Length:153 Identity:48/153 - (31%)
Similarity:65/153 - (42%) Gaps:58/153 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 TQEGNNKTPLTNFDLCQGHPRRLPITFDGSTVSR--FVWRTESILPSYITNSTNLQEKQLRKRFT 132
            |.....|:||.|                ..||.:  |.|..||              :|..|:.|
Mouse   137 TPASTAKSPLLN----------------SPTVGKQIFPWMKES--------------RQNTKQKT 171

  Fly   133 -----------DRKP---------RQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQV 177
                       |:.|         |.||:::||..||.||:.::||...:|||::..|:|||.|:
Mouse   172 SGSSSGESCAGDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQI 236

  Fly   178 KTWFQNRRTKWKK------QLTS 194
            |.||||||.|:||      .|||
Mouse   237 KIWFQNRRMKYKKDQKGKGMLTS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeodomain 134..190 CDD:459649 28/64 (44%)
Hoxa3NP_034582.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..151 5/29 (17%)
Antp-type hexapeptide 156..161 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..197 6/47 (13%)
COG5576 <182..309 CDD:227863 34/78 (44%)
Homeodomain 193..249 CDD:459649 27/55 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..354 5/12 (42%)
DUF4074 378..441 CDD:463833
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..443
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.