DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Hoxa10

DIOPT Version :10

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_032289.2 Gene:Hoxa10 / 15395 MGIID:96171 Length:416 Species:Mus musculus


Alignment Length:57 Identity:29/57 - (50%)
Similarity:38/57 - (66%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 RKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKK 190
            ||.|..|:..|...||.||..:.||:..:|:|:|:|:.||:.|||.||||||.|.||
Mouse   343 RKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeodomain 134..190 CDD:459649 27/55 (49%)
Hoxa10NP_032289.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..60
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..167
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..345 1/1 (100%)
Homeodomain 343..399 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.