DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Hlx

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_032276.1 Gene:Hlx / 15284 MGIID:96109 Length:476 Species:Mus musculus


Alignment Length:174 Identity:47/174 - (27%)
Similarity:72/174 - (41%) Gaps:30/174 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 HSSQNSLPKDNTNVTSSDISKLYAFSF---TQEGNNKTPLTNFDLCQGHPRRLPITFDGSTVSRF 104
            ||  .|.|..::......|.::.:..|   .:|||....||:. |..|.|..:.:.....:..:|
Mouse   159 HS--GSAPAPSSKDLKFGIDRILSAEFDPKVKEGNTLRDLTSL-LTGGRPAGVHLAGLQPSAGQF 220

  Fly   105 ------VWRTESILPSYITNSTNLQEKQLRKRF--------TDRKP----------RQAYSASQL 145
                  :....:||....:|..|..:.|.:..|        .|..|          |..:|..|.
Mouse   221 FASLDPISEASAILSPLSSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQR 285

  Fly   146 ERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWK 189
            :.||..|.:.||::...|.:|:..|.||:.|||.||||||.||:
Mouse   286 KGLEKRFEIQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 24/62 (39%)
HlxNP_032276.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..169 4/11 (36%)
COG5576 224..>341 CDD:227863 32/106 (30%)
Homeobox 276..329 CDD:278475 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..401 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..476
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.