DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and CUX1

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_005250207.1 Gene:CUX1 / 1523 HGNCID:2557 Length:1604 Species:Homo sapiens


Alignment Length:83 Identity:20/83 - (24%)
Similarity:37/83 - (44%) Gaps:6/83 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SILPSYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTE 174
            |:...|...::...:.||      :|||...:..:.|.|:..:....|.|.....:|:..|:|..
Human  1326 SVGTEYSQGASPQPQHQL------KKPRVVLAPEEKEALKRAYQQKPYPSPKTIEDLATQLNLKT 1384

  Fly   175 VQVKTWFQNRRTKWKKQL 192
            ..|..||.|.|::.:::|
Human  1385 STVINWFHNYRSRIRREL 1402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 14/52 (27%)
CUX1XP_005250207.1 Smc <106..464 CDD:224117
CUT 647..720 CDD:367059
PHA03247 846..>1032 CDD:223021
CUT 1038..1106 CDD:367059
CUT 1221..1294 CDD:367059
Homeobox 1346..1400 CDD:365835 14/53 (26%)
PRK12678 1404..>1493 CDD:237171
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.