DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34031 and En1

DIOPT Version :9

Sequence 1:	NP_001246894.1	Gene:	CG34031 / 3885665	FlyBaseID:	FBgn0054031	Length:	219	Species:	Drosophila melanogaster
Sequence 2:	NP_034263.2	Gene:	En1 / 13798	MGIID:	95389	Length:	401	Species:	Mus musculus

Alignment Length:	78	Identity:	33/78 - (42%)
Similarity:	52/78 - (66%)	Gaps:	2/78 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   113 PSYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQV 177
            ||....:..|::|:..|.  |::||.|::|.||:||:.||..::|::..:|..|::.|||.|.|:
Mouse   294 PSSGPRTRKLKKKKNEKE--DKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQI 356

  Fly   178 KTWFQNRRTKWKK 190
            |.||||:|.|.||
Mouse   357 KIWFQNKRAKIKK 369

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34031	NP_001246894.1	Homeobox	136..189	CDD:278475	25/52 (48%)
En1	NP_034263.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..102
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	138..167
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	229..253
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	293..315		6/22 (27%)
		Homeobox	315..368	CDD:278475	25/52 (48%)
		Engrail_1_C_sig	370..399	CDD:287495	33/78 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910