DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Dbx1

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001005232.1 Gene:Dbx1 / 13172 MGIID:94867 Length:335 Species:Mus musculus


Alignment Length:214 Identity:55/214 - (25%)
Similarity:86/214 - (40%) Gaps:46/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SRLNSCIEKSIQTKKKGKLGAFSIDSILSTSEAHSSQNSLPKDNTN--VTSSDISKLYAFSFTQE 72
            ||..|..:.::....:.....|.:::|||         |.|:..|:  :..|...|.:||.:   
Mouse    89 SRRGSSPQTALSPASEPTFLKFGVNAILS---------SAPRRETSPALLQSPPPKTFAFPY--- 141

  Fly    73 GNNKTPLTNFDLCQGHPRRLPITFDGS----TVSRFVWRTESILPSYITNSTNLQEKQLRKRFTD 133
                                   |:||    ..|.:...:.|::|...|.|..|..:...:|...
Mouse   142 -----------------------FEGSFQPFIRSSYFPASSSVVPIPGTFSWPLAARGKPRRGML 183

  Fly   134 RKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKI 198
            |  |..:|..|.:.||..|...||:|...|.:|:..|.|.:.|||.||||||.||:.  :...::
Mouse   184 R--RAVFSDVQRKALEKTFQKQKYISKPDRKKLASKLGLKDSQVKIWFQNRRMKWRN--SKEREL 244

  Fly   199 AHRHGLWIPTLPITTIIPN 217
            ....|....||| |.:.|:
Mouse   245 LSSGGCREQTLP-TKLNPH 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 23/52 (44%)
Dbx1NP_001005232.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..102 3/12 (25%)
Homeobox 184..237 CDD:278475 24/54 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..335 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.