DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and AgaP_AGAP009646

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_318681.1 Gene:AgaP_AGAP009646 / 1279024 VectorBaseID:AGAP009646 Length:394 Species:Anopheles gambiae


Alignment Length:158 Identity:46/158 - (29%)
Similarity:70/158 - (44%) Gaps:31/158 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 STSEAH----SSQNSLPKDNTNVTSSDISKLYAFSFTQEGNNKTPLTNFDLCQGHPRRLPITFDG 98
            |...||    ...:|:|.....|:.||:|...|    ..|::...:|        ||..|:.   
Mosquito   143 SGGNAHDHLADGLHSIPSPPITVSGSDMSSPGA----PTGSSSPQIT--------PRPTPVK--- 192

  Fly    99 STVSRFVWRTESILPSYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKR 163
               |.:.|..:....|         :....|..|..|.|..|:..|...||.||:..:|:::.::
Mosquito   193 ---SPYEWMKKQSYQS---------QPNPGKTRTKDKYRVVYTDQQRLELEKEFHYTRYITIRRK 245

  Fly   164 VELSKSLSLTEVQVKTWFQNRRTKWKKQ 191
            .||:::|.|:|.|||.||||||.|.:||
Mosquito   246 AELAQNLQLSERQVKIWFQNRRAKDRKQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 23/52 (44%)
AgaP_AGAP009646XP_318681.1 Homeobox 219..272 CDD:365835 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.