DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and AgaP_AGAP004664

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_311628.4 Gene:AgaP_AGAP004664 / 1272715 VectorBaseID:AGAP004664 Length:377 Species:Anopheles gambiae


Alignment Length:234 Identity:63/234 - (26%)
Similarity:84/234 - (35%) Gaps:88/234 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SIQTKKKG------KLGAFSIDSILSTSEAHSSQNSLPKDNTNVT-------------SSDISKL 64
            |:.::..|      |..||..|:.|        ::|.|..|.:..             ::||..:
Mosquito   120 SVSSQPSGPIHIPAKRPAFDTDTRL--------RHSYPWGNDSAADYAYHAQYPPYALATDIKPM 176

  Fly    65 YAFSFTQEGNNKTPLTNFDLCQGHP----------------RRLPITFD---------------- 97
            |..|:..|.|          .|.||                |...:|.|                
Mosquito   177 YYPSYPTEAN----------FQPHPYYPKYEPDAYITASTERSRGVTGDQPSLQSSYESYNSSGL 231

  Fly    98 -----------GSTVSRFVWRTESILPSYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENE 151
                       ||::|..|....|..||.....|.        ..|.||.|:.||..|...||.|
Mosquito   232 RSYSSETYPNPGSSLSVGVSGVGSCTPSNPLEWTG--------NVTVRKKRKPYSKFQTLELEKE 288

  Fly   152 FNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKK 190
            |..:.|:|..||.||:::|:|||.|||.||||||.|.||
Mosquito   289 FLFNAYVSKQKRWELARNLNLTERQVKIWFQNRRMKNKK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 28/52 (54%)
AgaP_AGAP004664XP_311628.4 Homeobox 273..326 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.