DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Barx2

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_038828.2 Gene:Barx2 / 12023 MGIID:109617 Length:283 Species:Mus musculus


Alignment Length:227 Identity:61/227 - (26%)
Similarity:88/227 - (38%) Gaps:62/227 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IQTKKKGKLGA-------FSIDSILSTSEAHSSQNSLPKDNTNVTSSDISKLYAFSFTQE-GNNK 76
            ::....|:|.|       |.||.|||..                |.....||..:|.... ....
Mouse     7 LRLSSPGQLKAARRRYKTFMIDEILSKE----------------TCDYFEKLSLYSVCPSLVVRP 55

  Fly    77 TPLTNFDLCQGHP--RRLP----ITFDGSTVSRFVWRTESILP---------------------- 113
            .||.:   |.|.|  |..|    ||...:.:|..|.....:.|                      
Mouse    56 KPLHS---CTGSPSLRAYPLLSVITRQPTVISHLVPTGSGLTPVLTRHPVAAAEAAAAAAETPGG 117

  Fly   114 SYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVK 178
            ..:.:|.:..|:...::...|:.|..::..||..||.:|...||||...|::|::||.||::|||
Mouse   118 EALASSESETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVK 182

  Fly   179 TWFQNRRTKWKKQLTSRLKIAHRHGLWIPTLP 210
            ||:||||.||||.:.       :.|...||.|
Mouse   183 TWYQNRRMKWKKMVL-------KGGQEAPTKP 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 26/52 (50%)
Barx2NP_038828.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..141 3/33 (9%)
Homeobox 140..193 CDD:306543 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..283 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.