DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Barhl1

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_476450.1 Gene:Barhl1 / 117232 RGDID:620648 Length:327 Species:Rattus norvegicus


Alignment Length:203 Identity:67/203 - (33%)
Similarity:94/203 - (46%) Gaps:26/203 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CIEKSIQTKKKGKLGAFSIDSILSTSEAHSSQNSLPKDNTNVTSS--------DISKLYAFS-FT 70
            |:|.|  |.:.|......:||.|     ...|.|.|..:..||||        |...|.|.: ::
  Rat    58 CLETS--TSRPGAASGPGLDSHL-----QPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYS 115

  Fly    71 QEGNNKTPLTNFDLC--QGHPRRLPI---TFDGSTVSRFVWRTESILPSYITNSTNLQEKQLRKR 130
            ..|....|.....|.  .|...|..:   ....|:.|.:..:.|.  ...|::|.:....:|:| 
  Rat   116 SSGQPAAPEPGGRLAAKAGEDFRDKLDKSVSSASSDSEYKVKEEG--DREISSSRDSPPVRLKK- 177

  Fly   131 FTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSR 195
              .||.|.|::..||.:||..|...|||||..|:||:.||:||:.|||||:||||||||:|....
  Rat   178 --PRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVG 240

  Fly   196 LKIAHRHG 203
            |::....|
  Rat   241 LELLAEAG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 30/52 (58%)
Barhl1NP_476450.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 11/38 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..181 13/72 (18%)
Homeobox 182..235 CDD:395001 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.