DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Pou2f3

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001099215.1 Gene:Pou2f3 / 116544 RGDID:621691 Length:430 Species:Rattus norvegicus


Alignment Length:188 Identity:45/188 - (23%)
Similarity:74/188 - (39%) Gaps:29/188 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGAFSIDSILSTSEAHSSQNSLPKDNTNVTSSDISKLYAFSFT-QEGNNKTPLTNFDLCQGHPRR 91
            |...|::..|..|:.......||....|...:|:.:|..|:.| ::...|...|..|:.....:.
  Rat   148 LSGSSLEPHLEASQHLPGPKHLPGPGGNDEPTDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKL 212

  Fly    92 LPITFDGSTVSRF---------VWRTESIL-------------PSYITNST--NLQEKQLRKRFT 132
            ....|..:|:|||         :.:.:.:|             ||..|.|:  .|.|...||   
  Rat   213 YGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSASTPSSYPTLSEVFGRK--- 274

  Fly   133 DRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKK 190
             ||.|.:...:....||..|..:...|..:...:::.||:.:..|:.||.|||.|.|:
  Rat   275 -RKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 14/52 (27%)
Pou2f3NP_001099215.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..180 7/31 (23%)
POU 176..250 CDD:197673 13/73 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..271 6/21 (29%)
Homeobox 277..330 CDD:278475 14/52 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.