Sequence 1: | NP_001246894.1 | Gene: | CG34031 / 3885665 | FlyBaseID: | FBgn0054031 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_446130.1 | Gene: | Rax / 114213 | RGDID: | 620371 | Length: | 342 | Species: | Rattus norvegicus |
Alignment Length: | 204 | Identity: | 57/204 - (27%) |
---|---|---|---|
Similarity: | 84/204 - (41%) | Gaps: | 46/204 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 SRLNSCIEKSIQTKKKGKLGAFSIDSILSTSEA-HSSQNSLPKDNTNVTSSDISKLYAFSFTQEG 73
Fly 74 NNKTP------LTNFDL---C----QGHPRRLPITFDGSTVSRFVWRTESILPSYITNSTNLQEK 125
Fly 126 QLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKK 190
Fly 191 QLTSRLKIA 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34031 | NP_001246894.1 | Homeobox | 136..189 | CDD:278475 | 22/52 (42%) |
Rax | NP_446130.1 | Octapeptide motif | 33..40 | 1/15 (7%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 49..141 | 23/112 (21%) | |||
Homeobox | 141..193 | CDD:278475 | 22/51 (43%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 209..295 | ||||
OAR | 316..331 | CDD:281777 | |||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 319..332 | ||||
Nuclear localization signal. /evidence=ECO:0000255 | 325..329 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |