DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Rax

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_446130.1 Gene:Rax / 114213 RGDID:620371 Length:342 Species:Rattus norvegicus


Alignment Length:204 Identity:57/204 - (27%)
Similarity:84/204 - (41%) Gaps:46/204 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SRLNSCIEKSIQTKKKGKLGAFSIDSILSTSEA-HSSQNSLPKDNTNVTSSDISKLYAFSFTQEG 73
            |||:|.         :..||....|.||.|..| .||:.|..:|......|...|..|     .|
  Rat    30 SRLHSI---------EAILGFTKEDGILDTFPAERSSRGSKERDPRLGARSACPKAPA-----GG 80

  Fly    74 NNKTP------LTNFDL---C----QGHPRRLPITFDGSTVSRFVWRTESILPSYITNSTNLQEK 125
            :..:|      :..|:.   |    ||..|..|    |..|.          |:  ...:.|.|:
  Rat    81 SESSPPAAPGLVPEFEATRPCYPKEQGEARPSP----GLPVG----------PA--AGDSKLSEE 129

  Fly   126 QLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKK 190
            :...:...|:.|..::..||..||..|....|..|..|.||:..::|.||:|:.||||||.||::
  Rat   130 EEPPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRR 194

  Fly   191 QLTSRLKIA 199
            |  .:|:::
  Rat   195 Q--EKLEVS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 22/52 (42%)
RaxNP_446130.1 Octapeptide motif 33..40 1/15 (7%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..141 23/112 (21%)
Homeobox 141..193 CDD:278475 22/51 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..295
OAR 316..331 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 319..332
Nuclear localization signal. /evidence=ECO:0000255 325..329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.