DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Hoxa3

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001300749.1 Gene:Hoxa3 / 103690130 RGDID:1561431 Length:444 Species:Rattus norvegicus


Alignment Length:153 Identity:48/153 - (31%)
Similarity:65/153 - (42%) Gaps:58/153 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 TQEGNNKTPLTNFDLCQGHPRRLPITFDGSTVSR--FVWRTESILPSYITNSTNLQEKQLRKRFT 132
            |.....|:||.|                ..||.:  |.|..||              :|..|:.|
  Rat   137 TPASTAKSPLLN----------------SPTVGKQIFPWMKES--------------RQNTKQKT 171

  Fly   133 -----------DRKP---------RQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQV 177
                       |:.|         |.||:::||..||.||:.::||...:|||::..|:|||.|:
  Rat   172 SGSSSGESCAGDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQI 236

  Fly   178 KTWFQNRRTKWKK------QLTS 194
            |.||||||.|:||      .|||
  Rat   237 KIWFQNRRMKYKKDQKGKGMLTS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 28/61 (46%)
Hoxa3NP_001300749.1 COG5576 <182..309 CDD:227863 34/78 (44%)
Homeobox 196..249 CDD:395001 27/52 (52%)
DUF4074 379..442 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.