powered by:
Protein Alignment CG34031 and LOC101732809
DIOPT Version :9
Sequence 1: | NP_001246894.1 |
Gene: | CG34031 / 3885665 |
FlyBaseID: | FBgn0054031 |
Length: | 219 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004915192.1 |
Gene: | LOC101732809 / 101732809 |
-ID: | - |
Length: | 111 |
Species: | Xenopus tropicalis |
Alignment Length: | 68 |
Identity: | 13/68 - (19%) |
Similarity: | 31/68 - (45%) |
Gaps: | 6/68 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 KRFTDRKPRQAYSASQLERLENEFNLD---KYLSVSKRVELSKSLSLTEVQVKTWFQNRRTK--W 188
|....|.|.:.|. .::.|::...:|: ::|...:.::..:.:...|..:|...:.|:.| |
Frog 45 KEAVRRLPPKVYD-DRIFRIKRALDLNIRQQHLPKQQWIKYEEDVHYLEPYLKEVIRERKEKQDW 108
Fly 189 KKQ 191
.|:
Frog 109 MKK 111
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0488 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.