DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and LOC101732809

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_004915192.1 Gene:LOC101732809 / 101732809 -ID:- Length:111 Species:Xenopus tropicalis


Alignment Length:68 Identity:13/68 - (19%)
Similarity:31/68 - (45%) Gaps:6/68 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KRFTDRKPRQAYSASQLERLENEFNLD---KYLSVSKRVELSKSLSLTEVQVKTWFQNRRTK--W 188
            |....|.|.:.|. .::.|::...:|:   ::|...:.::..:.:...|..:|...:.|:.|  |
 Frog    45 KEAVRRLPPKVYD-DRIFRIKRALDLNIRQQHLPKQQWIKYEEDVHYLEPYLKEVIRERKEKQDW 108

  Fly   189 KKQ 191
            .|:
 Frog   109 MKK 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 9/57 (16%)
LOC101732809XP_004915192.1 UCR_14kD 9..106 CDD:367012 10/61 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.