DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and LOC101731251

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_017951762.1 Gene:LOC101731251 / 101731251 -ID:- Length:882 Species:Xenopus tropicalis


Alignment Length:242 Identity:62/242 - (25%)
Similarity:93/242 - (38%) Gaps:56/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PHLEQD--KSRLN-SCIEKSIQTKKKGKLGAFSIDSILS----TSEAHSSQNSLPKDNTNVTSSD 60
            |:|..|  .|.|: :|:::.:.|:.......|:|....:    .:|...|::.:  ||...|..|
 Frog   478 PNLPNDIINSFLDKTCVQELVSTENILSFTHFTIQEFFAAFYYANEMQLSEDIM--DNGVQTRLD 540

  Fly    61 ISKLYAFSFTQEGNNKTPLTNFDLCQGHPRRLPITFDGSTVSRFV--WRTESILP-----SYITN 118
            ||..|...|.:..:....:.|.::...|     :..|.|..|...  |..|||:.     .||.|
 Frog   541 ISTGYLDLFNRFLSGLLSVRNQNVLSRH-----LKLDASRKSEAYRSWLAESIIEHCENGCYIFN 600

  Fly   119 STN-LQEKQ---LRKRFTDRKPRQAYSASQLERLENEFN------LDKYLS-VSKRVELSKSLSL 172
            ..: |.|:|   |..|.|....|       |...:|.|:      |..:|| |:..:|   .|.|
 Frog   601 LLHCLFEQQMDCLAARITPAMLR-------LNLSDNIFSPIDFDVLTYFLSLVNMDIE---ELDL 655

  Fly   173 TEVQVKTWFQNRRTKWKKQLTSRLKIAHRHGLW-----IPTLPITTI 214
            |..||       ..::.|||...|....|  ||     :.|..||.|
 Frog   656 TATQV-------NAQYLKQLQPYLNRCTR--LWMGENNLDTEMITVI 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 14/59 (24%)
LOC101731251XP_017951762.1 DD 27..105 CDD:387368
FISNA 123..196 CDD:373091
P-loop_NTPase 208..373 CDD:393355
NOD2_WH 449..506 CDD:375327 7/27 (26%)
NLRC4_HD2 508..609 CDD:375325 26/107 (24%)
LRR_RI <618..>770 CDD:393385 26/95 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.