DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and barhl1

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_004916717.1 Gene:barhl1 / 100491447 XenbaseID:XB-GENE-853661 Length:327 Species:Xenopus tropicalis


Alignment Length:200 Identity:57/200 - (28%)
Similarity:93/200 - (46%) Gaps:29/200 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KSRLNSCIEKSIQTKKKGKLGAFSIDSILSTSE-----AHSSQNSLPKDNTNVTSSDISKLYAFS 68
            :|.|...::.|..::.:....:|.|..||:..:     |..|.|..|       :.|::...|..
 Frog    73 ESHLQPGVQLSAPSQSRTVTSSFLIRDILADCKPLATCAPYSSNGQP-------THDLAHCLASK 130

  Fly    69 FTQEGNNKTPLTNFDLCQGHPRRLPITFDGSTVSRFVWRTESILPSYITNSTNLQEKQLRKRFTD 133
            ...:..:|...::...              |:.|.:..:.:......|::|.:....:|:|   .
 Frog   131 AADDFRDKLDKSSSST--------------SSESEYKGKVKEEGDREISSSRDSPPVRLKK---P 178

  Fly   134 RKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKI 198
            ||.|.|::..||.:||..|...|||||..|:||:.||:||:.|||||:||||||||:|....|::
 Frog   179 RKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLEL 243

  Fly   199 AHRHG 203
            ....|
 Frog   244 LAEAG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 30/52 (58%)
barhl1XP_004916717.1 Homeobox 182..235 CDD:365835 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.