DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and tm9sf1

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_002939067.1 Gene:tm9sf1 / 100486536 XenbaseID:XB-GENE-992446 Length:589 Species:Xenopus tropicalis


Alignment Length:140 Identity:26/140 - (18%)
Similarity:40/140 - (28%) Gaps:60/140 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 RTESILPSYITNSTNLQEKQLRKRFTDRKPRQA-----YSASQLERLEN---------------- 150
            |.:|:....:.:...:.|...|..|.....||.     .|.||:|.|..                
 Frog    63 RHKSLTLGEVLDGDRMAESMYRITFRQNVERQTLCEMKLSLSQVEELRRAIEELYYFEFVLDDIP 127

  Fly   151 ------------------------------EFNLDK--YLSVSKR-------VELSKSLSLTEVQ 176
                                          |:|.|:  |.:||.|       .::.::||||...
 Frog   128 IRGFLGYMEESGFLPHTHKIGLWAHLDINIEYNDDRIIYSNVSVRDVKPFSLDDVRETLSLTHTY 192

  Fly   177 VKTWFQNRRT 186
            ...||.:..|
 Frog   193 SIHWFPSTVT 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 21/111 (19%)
tm9sf1XP_002939067.1 EMP70 48..546 CDD:281048 26/140 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.