DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and LOC100485335

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_002938577.1 Gene:LOC100485335 / 100485335 -ID:- Length:281 Species:Xenopus tropicalis


Alignment Length:120 Identity:34/120 - (28%)
Similarity:55/120 - (45%) Gaps:27/120 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 DGSTVSRFVWRTESILPSYITNST----------------------NLQEKQLR---KRFTDRKP 136
            :|:..||..|..::|:... :|:|                      :|.|.|:|   ||...|. 
 Frog    17 NGAWGSRQDWYQDNIVTGQ-SNTTIDSCQQLDSSLDSEHQPGAANDDLDESQIRLQLKRKLQRN- 79

  Fly   137 RQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQ 191
            |.:::..|:|.||.||....|..|..|..|:..:.|.|.:::.||.|||.||:::
 Frog    80 RTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRRE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 19/52 (37%)
LOC100485335XP_002938577.1 Homeobox 80..133 CDD:365835 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.