DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and hoxd3

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_002935734.1 Gene:hoxd3 / 100038058 XenbaseID:XB-GENE-478462 Length:415 Species:Xenopus tropicalis


Alignment Length:226 Identity:61/226 - (26%)
Similarity:99/226 - (43%) Gaps:56/226 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IEKSIQTKKKGKLGAFSIDSILSTSEAHSS----QNSLPKD--------------NTNVTSSDIS 62
            ::|:...:..|..|.::.....|.|...|.    |:||..|              ..|..::|||
 Frog    17 MQKTAYYENSGLFGGYTYAKPESYSYGPSQQQYPQSSLDSDYPSTACSIQPAAIRAPNHKANDIS 81

  Fly    63 KLYAFSFTQEGNNKTP-LTNFDLCQGH-----PRRLPITFDGS----------------TVSR-- 103
            .....:.:.:.:|:.| ::|    |.|     |...|...:.|                |:|:  
 Frog    82 GSCMRTTSSQNSNQAPSISN----QQHQAPSLPPSSPSHGNSSAQKKSKSSNSSGSSQATLSKQI 142

  Fly   104 FVWRTESILPSYITNST---------NLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLS 159
            |.|..||...:...|::         |.:||..... :.::.|.||:::||..||.||:.::||.
 Frog   143 FPWMKESRQNAKQKNTSSSSSTPPGENCEEKSPTGP-SSKRVRTAYTSAQLVELEKEFHFNRYLC 206

  Fly   160 VSKRVELSKSLSLTEVQVKTWFQNRRTKWKK 190
            ..:|||::..|:|||.|:|.||||||.|:||
 Frog   207 RPRRVEMANLLNLTERQIKIWFQNRRMKYKK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 27/52 (52%)
hoxd3XP_002935734.1 Homeobox 184..237 CDD:365835 27/52 (52%)
DUF4074 352..413 CDD:372548
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.