DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and barx2

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_001342044.1 Gene:barx2 / 100002200 ZFINID:ZDB-GENE-081120-4 Length:268 Species:Danio rerio


Alignment Length:233 Identity:68/233 - (29%)
Similarity:94/233 - (40%) Gaps:76/233 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QDKSRLNSCIEKSIQTKKKGKLGAFSIDSILSTSEA----------------------HSSQNSL 49
            |.:.||.|    |.|.|...:...|.||.|||....                      ||...|:
Zfish     4 QAELRLAS----SAQLKAARRYKTFMIDEILSKETCDYFEKLSLYSVCPSLIVRPKPLHSCTGSV 64

  Fly    50 PKDN-------TNVTSSDISKLYAFSFTQEGNNKTPLTNFDLCQGHPRRLPITFDGSTVSRFVWR 107
            |..:       |:..||.:|.|...|.....:::|||:             |:.:..        
Zfish    65 PLRSYPLLSVITHQASSSVSPLSQSSPHLPPSSETPLS-------------ISSESD-------- 108

  Fly   108 TESILPSYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSL 172
            ||...|            :|:|   .|:.|..::..||..||.:|...||||...|::|::||.|
Zfish   109 TEHCTP------------RLKK---PRRSRTIFTELQLLGLEKKFQKQKYLSTPDRLDLAQSLGL 158

  Fly   173 TEVQVKTWFQNRRTKWKKQLTSRLKIAHRHGLWIPTLP 210
            |::|||||:||||.||||.:   ||..|.    .||.|
Zfish   159 TQLQVKTWYQNRRMKWKKMV---LKGGHE----APTKP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 26/52 (50%)
barx2XP_001342044.1 Homeobox 122..175 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.